Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006677-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006677-A01, RRID:AB_894274
- Product name
- SPAM1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SPAM1.
- Antigen sequence
RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVL
CQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKF
TVRGKPTLEDLEQFSEKFYCSCYSTLSCKE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hyaluronan synthases and hyaluronidases in nasal polyps.
The impact of oxidative stress on chaperone-mediated human sperm-egg interaction.
Expression of a functional recombinant oleosin-human hyaluronidase hPH-20 fusion in Arabidopsis thaliana.
Investigation of the mechanisms by which the molecular chaperone HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition.
Autodisplay of catalytically active human hyaluronidase hPH-20 and testing of enzyme inhibitors.
Hyaluronidase expression and activity is regulated by pro-inflammatory cytokines in human airway epithelial cells.
Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS
European archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery 2016 Jul;273(7):1801-8
European archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery 2016 Jul;273(7):1801-8
The impact of oxidative stress on chaperone-mediated human sperm-egg interaction.
Bromfield EG, Aitken RJ, Anderson AL, McLaughlin EA, Nixon B
Human reproduction (Oxford, England) 2015 Nov;30(11):2597-613
Human reproduction (Oxford, England) 2015 Nov;30(11):2597-613
Expression of a functional recombinant oleosin-human hyaluronidase hPH-20 fusion in Arabidopsis thaliana.
Li H, Yang J, Chen Y, Guan L, Du L, Guo Y, Wang W, Wang L, Li H, Jiang C, Li X
Protein expression and purification 2014 Nov;103:23-7
Protein expression and purification 2014 Nov;103:23-7
Investigation of the mechanisms by which the molecular chaperone HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition.
Redgrove KA, Anderson AL, McLaughlin EA, O'Bryan MK, Aitken RJ, Nixon B
Molecular human reproduction 2013 Mar;19(3):120-35
Molecular human reproduction 2013 Mar;19(3):120-35
Autodisplay of catalytically active human hyaluronidase hPH-20 and testing of enzyme inhibitors.
Kaessler A, Olgen S, Jose J
European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences 2011 Jan 18;42(1-2):138-47
European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences 2011 Jan 18;42(1-2):138-47
Hyaluronidase expression and activity is regulated by pro-inflammatory cytokines in human airway epithelial cells.
Monzón ME, Manzanares D, Schmid N, Casalino-Matsuda SM, Forteza RM
American journal of respiratory cell and molecular biology 2008 Sep;39(3):289-95
American journal of respiratory cell and molecular biology 2008 Sep;39(3):289-95
No comments: Submit comment
No validations: Submit validation data