HPA017984

SPAM1 antibody from Sigma-Aldrich
HYAL5, PH-20, SPAG15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017984
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017984, RRID:AB_1857413
Product name
Anti-SPAM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017984
Antibody type
Polyclonal
Antigen
Hyaluronidase PH-20 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQG
VCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK
PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAV
DVCIADGVCIDAFLKPPM
Storage
-20C
Provider Type Product Number
- No reagents -