ABIN501366

KCNJ5 antibody from antibodies-online
CIR, GIRK4, KATP1, Kir3.4, LQT13

Antibody data

Product number
ABIN501366
Provider
antibodies-online
Product name
anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody
Provider product page
antibodies-online - ABIN501366
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNJ5 antibody: synthetic peptide directed towards the N terminal of human KCNJ5
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Porcine
Host
Rabbit
Antigen sequence
AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIA
TDRTR LLAEGKKPRQ
Vial size
50 µg
Provider Type Product Number
- No reagents -