Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501366 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 5 (KCNJ5) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNJ5 antibody: synthetic peptide directed towards the N terminal of human KCNJ5
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIA
TDRTR LLAEGKKPRQ- Vial size
- 50 µg
Submitted references Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
Ji W, Foo JN, O'Roak BJ, Zhao H, Larson MG, Simon DB, Newton-Cheh C, State MW, Levy D, Lifton RP
Nature genetics 2008 May;40(5):592-9
Nature genetics 2008 May;40(5):592-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting