Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00090411-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00090411-M01, RRID:AB_426106
- Product name
- MCFD2 monoclonal antibody (M01), clone 3A5-G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MCFD2.
- Antigen sequence
MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQ
PGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQ
ELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEG
SEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAE
FAKSLQ- Isotype
- IgG
- Antibody clone number
- 3A5-G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MCFD2 expression in transfected 293T cell line by MCFD2 monoclonal antibody (M01), clone 3A5-G4.Lane 1: MCFD2 transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MCFD2 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MCFD2 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MCFD2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol