Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29314 - Provider product page
- Provider
- Abnova Corporation
- Product name
- NT5E polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human NT5E.
- Antigen sequence
EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQ
ISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPG
TNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGF
EMDKLIAQK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: NIH-3T3 cell lysate, Lane 2: NBT-II cell lysate with NT5E polyclonal antibody (Cat# PAB29314) at 1:100 - 1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence staining of U-2 OS cells with NT5E polyclonal antibody (Cat# PAB29314) under 1-4 ug/mL working concentration.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum tissue with NT5E polyclonal antibody (Cat# PAB29314) at 1:1000 - 1:2500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)