HPA017357

NT5E antibody from Sigma-Aldrich
CALJA, CD73, eN, eNT, NT5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017357
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017357, RRID:AB_1846330
Product name
Anti-NT5E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017357
Antibody type
Polyclonal
Antigen
5'-nucleotidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQ
ISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPG
TNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGF
EMDKLIAQK
Storage
-20C
Provider Type Product Number
- No reagents -