HPA003043

BAIAP2L2 antibody from Atlas Antibodies
FLJ22582, pinkbar
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003043
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003043, RRID:AB_2227864
Product name
Anti-BAIAP2L2
Provider product page
Atlas Antibodies - HPA003043
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKAL
EEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR
SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRT
PSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKK
LMSSEQYPP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -