HPA003043

BAIAP2L2 antibody from Sigma-Aldrich
FLJ22582
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003043
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003043, RRID:AB_2227864
Product name
Anti-BAIAP2L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003043
Antibody type
Polyclonal
Antigen
Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKAL
EEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR
SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRT
PSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKK
LMSSEQYPP
Storage
-20C
Provider Type Product Number
- No reagents -