Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405918 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Adenylate Cyclase 10 (Soluble) (ADCY10) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SAC antibody: synthetic peptide directed towards the N terminal of human SAC
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSV
TYNGS NLPAYFFKEL- Vial size
- 50 µg
Submitted references Soluble adenylyl cyclase activity is necessary for retinal ganglion cell survival and axon growth.
Soluble adenylyl cyclase is localized to cilia and contributes to ciliary beat frequency regulation via production of cAMP.
Corredor RG, Trakhtenberg EF, Pita-Thomas W, Jin X, Hu Y, Goldberg JL
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 May 30;32(22):7734-44
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 May 30;32(22):7734-44
Soluble adenylyl cyclase is localized to cilia and contributes to ciliary beat frequency regulation via production of cAMP.
Schmid A, Sutto Z, Nlend MC, Horvath G, Schmid N, Buck J, Levin LR, Conner GE, Fregien N, Salathe M
The Journal of general physiology 2007 Jul;130(1):99-109
The Journal of general physiology 2007 Jul;130(1):99-109
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting