HPA015243

ADCY10 antibody from Sigma-Aldrich
HCA2, RP1-313L4.2, SAC, SACI, Sacy
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015243
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015243, RRID:AB_1856540
Product name
Anti-ADCY10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015243
Antibody type
Polyclonal
Antigen
Adenylate cyclase type 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQK
CGLFLNTALRLSETQGNILEKCWLNMNKESWYSTS
ELKEDQWLQTILSLPSW
Storage
-20C
Provider Type Product Number
- No reagents -