HPA017749

ADCY10 antibody from Atlas Antibodies
HCA2, RP1-313L4.2, SAC, SACI, Sacy
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017749
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017749, RRID:AB_1856541
Product name
Anti-ADCY10
Provider product page
Atlas Antibodies - HPA017749
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RNTTYIVIGAVQPNDISNKICLDLNVSCISKELDS
YLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEE
KTNRTWNNLFKYSIKLTEKLNMVTLHSDKESEEVC
HLTSGVRLKNLSPPTSLKEISLI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -