H00051517-M07

NCKIPSD antibody from Abnova Corporation
AF3P21, DIP1, ORF1, SPIN90, WASLBP, WISH

Antibody data

Product number
H00051517-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051517-M07, RRID:AB_1137326
Product name
NCKIPSD monoclonal antibody (M07), clone 2E4
Provider product page
Abnova Corporation - H00051517-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NCKIPSD.
Antigen sequence
MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWW
LAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRA
IEAVHNTAMRDGGKYSLEQRGVLQKLIHH
Isotype
IgG
Antibody clone number
2E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -