Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003211-M13 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003211-M13, RRID:AB_1204490
- Product name
- HOXB1 monoclonal antibody (M13), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXB1.
- Antigen sequence
LGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPG
PYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPS
EPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSG
LRTNF- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HOXB1 expression in transfected 293T cell line by HOXB1 monoclonal antibody (M13), clone 2E5.Lane 1: HOXB1 transfected lysate(25 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HOXB1 transfected lysate using anti-HOXB1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HOXB1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol