PAB20177

RIBC2 antibody from Abnova Corporation
C22orf11, DKFZp566F0546, FLJ25720

Antibody data

Product number
PAB20177
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20177, RRID:AB_10964975
Product name
RIBC2 polyclonal antibody
Provider product page
Abnova Corporation - PAB20177
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RIBC2.
Antigen sequence
DKIMCILENRKKRDRKNLCRAINDFQQSFQKPETR
REFDLSDPLALKKDLPARQSDNDVRNTISGMQKFM
GEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQ
KCAEALYTETRLQFDETAKHLQKLESTTRKAVCAS
VKDF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -