HPA003210

RIBC2 antibody from Atlas Antibodies
C22orf11, DKFZp566F0546, FLJ25720
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003210
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003210, RRID:AB_1078347
Product name
Anti-RIBC2
Provider product page
Atlas Antibodies - HPA003210
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DKIMCILENRKKRDRKNLCRAINDFQQSFQKPETR
REFDLSDPLALKKDLPARQSDNDVRNTISGMQKFM
GEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQ
KCAEALYTETRLQFDETAKHLQKLESTTRKAVCAS
VKDF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -