HPA003210

RIBC2 antibody from Sigma-Aldrich
C22orf11, DKFZp566F0546, FLJ25720
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003210
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003210, RRID:AB_1078347
Product name
Anti-RIBC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003210
Antibody type
Polyclonal
Antigen
RIB43A-like with coiled-coils protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKIMCILENRKKRDRKNLCRAINDFQQSFQKPETR
REFDLSDPLALKKDLPARQSDNDVRNTISGMQKFM
GEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQ
KCAEALYTETRLQFDETAKHLQKLESTTRKAVCAS
VKDF
Storage
-20C
Provider Type Product Number
- No reagents -