HPA017761

CYP7B1 antibody from Sigma-Aldrich
SPG5A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017761
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017761, RRID:AB_1847455
Product name
Anti-CYP7B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017761
Antibody type
Polyclonal
Antigen
Cytochrome P450 7B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICL
ESSIFEALRLSSYSTTIRFVEEDLTLSSETGDYCV
RKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIEDG
KKKTTFFKRGKKLKCYLMPFGTGTSKC
Storage
-20C
Provider Type Product Number
- No reagents -