HPA014351

ENTPD7 antibody from MilliporeSigma / Merck KGaA
FLJ30978, LALP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014351
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014351, RRID:AB_1848183
Product name
Anti-ENTPD7 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014351
Antibody type
Polyclonal
Antigen
Ectonucleoside triphosphate diphosphohydrolase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPV
GLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARS
NTSQASLNGIYQSPIDFNNSEF
Storage
-20C
Provider Type Product Number
- No reagents -