HPA003246

TNFRSF13C antibody from Atlas Antibodies
BAFFR, CD268
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003246
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003246, RRID:AB_611330
Product name
Anti-TNFRSF13C
Provider product page
Atlas Antibodies - HPA003246
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILS
PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELG
STELVTTKTAGPEQQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -