HPA003246

TNFRSF13C antibody from Sigma-Aldrich
BAFFR, CD268
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003246
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003246, RRID:AB_1078264
Product name
Anti-TNFRSF13C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003246
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 13C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILS
PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELG
STELVTTKTAGPEQQ
Storage
-20C
Provider Type Product Number
- No reagents -