HPA014549

LRRC66 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014549
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014549, RRID:AB_1853062
Product name
Anti-LRRC66 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014549
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 66
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTEQSLWDSQMEFSKERQVSSSIDLLSIQQPRLSG
ARAEEALSAHYSEVPYGDPRDTGPSVFPPRWDSGL
DVTPANKEPVQKSTPSDTCCELESDCDSDEGSLFT
LSSISSESARSKTEEAVPDEESLQDESSGASKD
Storage
-20C
Provider Type Product Number
- No reagents -