HPA027839

LRRC66 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027839
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027839, RRID:AB_10602705
Product name
Anti-LRRC66 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027839
Antibody type
Polyclonal
Antigen
leucine rich repeat containing 66 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRNKLSDTPKGLWKLKSLQSLDLSFNGILQIGWSD
FHNCLQLENLCLKSNKIFKIPPQAFKDLKKLQVID
LSNNALITILPMMIIALEFPHLVVDLADNNWQCDD
SVAVFQNFISESWRKKWNVICNRSI
Storage
-20C
Provider Type Product Number
- No reagents -