Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311472 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Cytochrome P450, Family 11, Subfamily A, Polypeptide 1 (CYP11A1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
- LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTE
 MLAGG VDTTSMTLQW
- Vial size
- 50 µg
Submitted references		Analysis of mRNA expression for steroidogenic enzymes in the remaining adrenal cortices attached to adrenocortical adenomas.
				
		
	
			Shigematsu K, Nakagaki T, Yamaguchi N, Kawai K, Sakai H, Takahara O
European journal of endocrinology / European Federation of Endocrine Societies 2008 Jun;158(6):867-78
		European journal of endocrinology / European Federation of Endocrine Societies 2008 Jun;158(6):867-78
				No comments: Submit comment	
	
			
			No validations: Submit validation data