Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502173 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytochrome P450, Family 2, Subfamily C, Polypeptide 19 (CYP2C19) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRY
IDLIP TSLPHAVTCD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Breast cancer risk reduction and membrane-bound catechol O-methyltransferase genetic polymorphisms.
Ji Y, Olson J, Zhang J, Hildebrandt M, Wang L, Ingle J, Fredericksen Z, Sellers T, Miller W, Dixon JM, Brauch H, Eichelbaum M, Justenhoven C, Hamann U, Ko Y, BrĂ¼ning T, Chang-Claude J, Wang-Gohrke S, Schaid D, Weinshilboum R
Cancer research 2008 Jul 15;68(14):5997-6005
Cancer research 2008 Jul 15;68(14):5997-6005
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting