Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405109 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRIK5 antibody: synthetic peptide directed towards the middle region of human GRIK5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTI
TAERE KVIDFSKPFM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association study of polymorphisms in the GluR7, KA1 and KA2 kainate receptor genes (GRIK3, GRIK4, GRIK5) with schizophrenia.
Shibata H, Aramaki T, Sakai M, Ninomiya H, Tashiro N, Iwata N, Ozaki N, Fukumaki Y
Psychiatry research 2006 Jan 30;141(1):39-51
Psychiatry research 2006 Jan 30;141(1):39-51
No comments: Submit comment
No validations: Submit validation data