Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000217-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000217-M01, RRID:AB_581653
- Product name
- ALDH2 monoclonal antibody (M01), clone 1E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALDH2.
- Antigen sequence
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTY
GLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKV
PQKNS- Isotype
- IgG
- Antibody clone number
- 1E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Laser microdissection and two-dimensional difference gel electrophoresis reveal the role of a novel macrophage-capping protein in lymph node metastasis in gastric cancer.
Network clustering revealed the systemic alterations of mitochondrial protein expression.
Ichikawa H, Kanda T, Kosugi S, Kawachi Y, Sasaki H, Wakai T, Kondo T
Journal of proteome research 2013 Aug 2;12(8):3780-91
Journal of proteome research 2013 Aug 2;12(8):3780-91
Network clustering revealed the systemic alterations of mitochondrial protein expression.
Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK
PLoS computational biology 2011 Jun;7(6):e1002093
PLoS computational biology 2011 Jun;7(6):e1002093
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALDH2 monoclonal antibody (M01), clone 1E5 Western Blot analysis of ALDH2 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ALDH2 expression in transfected 293T cell line by ALDH2 monoclonal antibody (M01), clone 1E5.Lane 1: ALDH2 transfected lysate(56.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ALDH2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol