HPA028602

IQCC antibody from MilliporeSigma / Merck KGaA
FLJ10547
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028602
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028602, RRID:AB_10600298
Product name
Anti-IQCC antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028602
Antibody type
Polyclonal
Antigen
IQ motif containing C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTVRTQELGLSEDHIIWDGTLGGPEHSVLDLWRTK
PPKGQAPTDRSSRDGTSNEPSHEGQKKQRTIPWRS
KSPEILSSTKAGCTGEEQWRGRPWKTEPPG
Storage
-20C
Provider Type Product Number
- No reagents -