HPA003080

TANGO2 antibody from Atlas Antibodies
C22orf25, DKFZp761P1121
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003080
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003080, RRID:AB_611914
Product name
Anti-TANGO2
Provider product page
Atlas Antibodies - HPA003080
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPVNVQRREDSATEGSHRLILAANRDEFYSRPSKL
ADFWGNNNEILSGLDMEEGKEGGTWLGISTRGKLA
ALTNYLQPQLDWQARGRGELVTHFLTTDVDSLSYL
KKVSMEGHLYNGFNLIAADLSTAKGDVICYYGNRG
EPDPIVLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -