HPA003080

TANGO2 antibody from Sigma-Aldrich
C22orf25, DKFZp761P1121
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003080
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003080, RRID:AB_1078350
Product name
Anti-C22orf25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003080
Antibody type
Polyclonal
Antigen
Uncharacterized protein C22orf25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPVNVQRREDSATEGSHRLILAANRDEFYSRPSKL
ADFWGNNNEILSGLDMEEGKEGGTWLGISTRGKLA
ALTNYLQPQLDWQARGRGELVTHFLTTDVDSLSYL
KKVSMEGHLYNGFNLIAADLSTAKGDVICYYGNRG
EPDPIVLT
Storage
-20C
Provider Type Product Number
- No reagents -