Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026259-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026259-A01, RRID:AB_463242
- Product name
- FBXW8 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant FBXW8.
- Antigen sequence
VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVP
YQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAF
QSPLPVCRSSCDAMATHYYDLALAFPYNHV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Effect of ursolic acid on MAPK in cyclin D1 signaling and RING-type E3 ligase (SCF E3s) in two endometrial cancer cell lines.
A novel mechanism by which thiazolidinediones facilitate the proteasomal degradation of cyclin D1 in cancer cells.
Achiwa Y, Hasegawa K, Udagawa Y
Nutrition and cancer 2013;65(7):1026-33
Nutrition and cancer 2013;65(7):1026-33
A novel mechanism by which thiazolidinediones facilitate the proteasomal degradation of cyclin D1 in cancer cells.
Wei S, Yang HC, Chuang HC, Yang J, Kulp SK, Lu PJ, Lai MD, Chen CS
The Journal of biological chemistry 2008 Sep 26;283(39):26759-70
The Journal of biological chemistry 2008 Sep 26;283(39):26759-70
No comments: Submit comment
No validations: Submit validation data