HPA030230

MTO1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030230
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030230, RRID:AB_10598910
Product name
Anti-MTO1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030230
Antibody type
Polyclonal
Antigen
mitochondrial translation optimization 1 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPDNADSRLTLRGYKDAGCVSQQRYERACWMKSSL
EEGISVLKSIEFLSSKWKKLIPEASISTSRSLPVR
ALDVLKYE
Storage
-20C
Provider Type Product Number
- No reagents -