Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084108-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084108-M01, RRID:AB_1137352
- Product name
- PCGF6 monoclonal antibody (M01), clone 2B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCGF6.
- Antigen sequence
- AVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEF
 IGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRR
 KMGLDPACQVDIICGDHLLEQYQTLREIRR
- Isotype
- IgG
- Antibody clone number
- 2B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged PCGF6 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunofluorescence of monoclonal antibody to PCGF6 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol