Antibody data

Product number
H00022797-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022797-M08, RRID:AB_1137493
Product name
TFEC monoclonal antibody (M08), clone 4F11
Provider product page
Abnova Corporation - H00022797-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TFEC.
Antigen sequence
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDS
DAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYS
GEQGISPINMGLTSASCPS
Isotype
IgG
Antibody clone number
4F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -