Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084678-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084678-M09, RRID:AB_518812
- Product name
- FBXL10 monoclonal antibody (M09), clone 5G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FBXL10.
- Antigen sequence
LGKKPKAPALRFLKRTLSNESEESVKSTTLAVDYP
KTPTGSPATEVSAKWTHLTEFELKGLKALVEKLES
LPENKKCVPEGIEDPQALLEGVKNVLKEH- Isotype
- IgG
- Antibody clone number
- 5G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references JHDM1B/FBXL10 is a nucleolar protein that represses transcription of ribosomal RNA genes.
Frescas D, Guardavaccaro D, Bassermann F, Koyama-Nasu R, Pagano M
Nature 2007 Nov 8;450(7167):309-13
Nature 2007 Nov 8;450(7167):309-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FBXL10 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FBXL10 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol