H00003192-M03
antibody from Abnova Corporation
		Targeting: HNRNPU
		
		C1orf199, FLJ30202, FLJ37978, HNRNPU-AS1, HNRPU, NCRNA00201, SAF-A	
	
	
	
	
Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00003192-M03 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00003192-M03, RRID:AB_1674799
 - Product name
 - HNRNPU monoclonal antibody (M03), clone 4G11
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant HNRNPU.
 - Antigen sequence
 LLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDV
ITCFANFESDEVELSYAKNGQDLGVAFKISKEVLA
GRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTF
IQNV- Isotype
 - IgG
 - Antibody clone number
 - 4G11
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - HNRNPU monoclonal antibody (M03), clone 4G11. Western Blot analysis of HNRNPU expression in NIH/3T3(Cat # L018V1 ).
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged HNRNPU is 0.3 ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol