Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15687 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15687, RRID:AB_10676958
- Product name
- Tsc1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Tsc1.
- Antigen sequence
KYLEDVKSQASGQLLAAESRYEAQRKITRVLELEI
LDLYGRLEKDGRLRKLEEDRAEAAEAAEERLDCCS
DGCTDSLVGHNEEASGHNGETRTSRPGGTRASCGG
RVTGGSSSSSSELSTPEKPPSQRFSSRWEPALGEP
SSSIPTTVGSLPSSKSFLGMKARELFRNKSESQCD
EDSVTMSSSSLSETLKTELGKDSGTENKTSLSLDA
PHPSSPNSDNVGQLHIMDYNETHPEHS- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Identification of the tuberous sclerosis gene TSC1 on chromosome 9q34.
Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
Identification of the tuberous sclerosis gene TSC1 on chromosome 9q34.
van Slegtenhorst M, de Hoogt R, Hermans C, Nellist M, Janssen B, Verhoef S, Lindhout D, van den Ouweland A, Halley D, Young J, Burley M, Jeremiah S, Woodward K, Nahmias J, Fox M, Ekong R, Osborne J, Wolfe J, Povey S, Snell RG, Cheadle JP, Jones AC, Tachataki M, Ravine D, Sampson JR, Reeve MP, Richardson P, Wilmer F, Munro C, Hawkins TL, Sepp T, Ali JB, Ward S, Green AJ, Yates JR, Kwiatkowska J, Henske EP, Short MP, Haines JH, Jozwiak S, Kwiatkowski DJ
Science (New York, N.Y.) 1997 Aug 8;277(5327):805-8
Science (New York, N.Y.) 1997 Aug 8;277(5327):805-8
No comments: Submit comment
No validations: Submit validation data