Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405971 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Pyruvate Dehydrogenase beta (PDHB) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRP
ICEFM TFNFSMQAID- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutations of the E1beta subunit gene (PDHB) in four families with pyruvate dehydrogenase deficiency.
Okajima K, Korotchkina LG, Prasad C, Rupar T, Phillips JA 3rd, Ficicioglu C, Hertecant J, Patel MS, Kerr DS
Molecular genetics and metabolism 2008 Apr;93(4):371-80
Molecular genetics and metabolism 2008 Apr;93(4):371-80
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting