Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001965-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001965-M01, RRID:AB_425412
- Product name
- EIF2S1 monoclonal antibody (M01), clone 3H12-C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant EIF2S1.
- Antigen sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVS
LLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC
VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKS
KTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD
KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREV
LINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE
ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERT
EGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD
TDETELARQMERLERENAEVDGDDDAEEMEAKAED- Isotype
- IgG
- Antibody clone number
- 3H12-C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references IGF2BP1 enhances HCV IRES-mediated translation initiation via the 3'UTR.
Weinlich S, Hüttelmaier S, Schierhorn A, Behrens SE, Ostareck-Lederer A, Ostareck DH
RNA (New York, N.Y.) 2009 Aug;15(8):1528-42
RNA (New York, N.Y.) 2009 Aug;15(8):1528-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EIF2S1 monoclonal antibody (M01), clone 3H12-C11 Western Blot analysis of EIF2S1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EIF2S1 monoclonal antibody (M01), clone 3H12-C11. Western Blot analysis of EIF2S1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EIF2S1 expression in transfected 293T cell line by EIF2S1 monoclonal antibody (M01), clone 3H12-C11.Lane 1: EIF2S1 transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EIF2S1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to EIF2S1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol