H00010578-M08

GNLY antibody from Abnova Corporation
D2S69E, LAG-2, LAG2, NKG5, TLA519

Antibody data

Product number
H00010578-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010578-M08, RRID:AB_1237723
Product name
GNLY monoclonal antibody (M08), clone 2A6
Provider product page
Abnova Corporation - H00010578-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GNLY.
Antigen sequence
LAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMV
DKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQ
SRVTQGLVAGETAQQICEDLRLCIPSTGPL
Isotype
IgG
Antibody clone number
2A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -