ABIN182549
antibody from antibodies-online
Targeting: RUVBL2
ECP51, INO80J, Reptin52, RVB2, TIH2, TIP48, TIP49b
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182549 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RuvB-Like 2 (E. Coli) (RUVBL2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIES
LTKDK VQAGDVITID- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Reptin52 expression during in vitro neural differentiation of human embryonic stem cells.
Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity.
Barthéléry M, Jaishankar A, Salli U, Vrana KE
Neuroscience letters 2009 Mar 6;452(1):47-51
Neuroscience letters 2009 Mar 6;452(1):47-51
Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity.
Bauer A, Chauvet S, Huber O, Usseglio F, Rothbächer U, Aragnol D, Kemler R, Pradel J
The EMBO journal 2000 Nov 15;19(22):6121-30
The EMBO journal 2000 Nov 15;19(22):6121-30
No comments: Submit comment
No validations: Submit validation data