H00005034-B01P

P4HB antibody from Abnova Corporation
DSI, ERBA2L, GIT, P4Hbeta, PDI, PDIA1, PO4DB, PO4HB, PROHB

Antibody data

Product number
H00005034-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005034-B01P, RRID:AB_1578345
Product name
P4HB purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00005034-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human P4HB protein.
Antigen sequence
MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFA
EALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKL
KAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFF
RNGDTASPKEYTAGREADDIVNWLKKRTGPAATTL
PDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQA
AEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFD
EGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTA
PKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAE
SFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAV
RLITLEEEMTKYKPESEELTAERITEFCHRFLEGK
IKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEK
KNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVI
DYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEA
EEPDMEEDDDQKAVKDEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -