HPA018884

P4HB antibody from Sigma-Aldrich
DSI, ERBA2L, GIT, P4Hbeta, PDI, PDIA1, PO4DB, PO4HB, PROHB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018884, RRID:AB_1854896
Product name
Anti-P4HB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018884
Antibody type
Polyclonal
Antigen
Protein disulfide-isomerase Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDY
DGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILE
FFGLKKEECPAVRLITLEEEMTKYKPESEELTAER
ITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLV
GKNF
Storage
-20C
Provider Type Product Number
- No reagents -