HPA018884

P4HB antibody from Atlas Antibodies
DSI, ERBA2L, GIT, P4Hbeta, PDI, PDIA1, PO4DB, PO4HB, PROHB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018884
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018884, RRID:AB_1854896
Product name
Anti-P4HB
Provider product page
Atlas Antibodies - HPA018884
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDY
DGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILE
FFGLKKEECPAVRLITLEEEMTKYKPESEELTAER
ITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLV
GKNF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -