HPA003270

KCNJ4 antibody from Sigma-Aldrich
HIR, hIRK2, HRK1, IRK3, Kir2.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003270, RRID:AB_1079658
Product name
Anti-KCNJ4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003270
Antibody type
Polyclonal
Antigen
Inward rectifier potassium channel 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPL
DNISYRRESAI
Storage
-20C
Provider Type Product Number
- No reagents -