Antibody data

Product number
H00059285-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00059285-B01, RRID:AB_1204051
Product name
CACNG6 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00059285-B01
Antibody type
Polyclonal
Antigen
CACNG6 (NP_665813, 1 a.a. ~ 260 a.a) full-length human protein.
Description
Mouse polyclonal antibody raised against a full-length human CACNG6 protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPER
EGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKA
NGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGP
AELPGEANCTYFKFFTTGENARIFQRTTKKEVNLA
AAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGA
VCFGLSGLLLLVSLEVFRHSVRALLQRVSPEPPPA
PRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPS
WPWGSLCPKRGHRAT
Vial size
50 μL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -