Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN633957 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Plasminogen (PLG) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Submitted references The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated.
A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro.
Giraud A, Chabaud O, Lejeune PJ, Barbaria J, Mallet B
Biochemical and biophysical research communications 2006 Aug 4;346(3):746-50
Biochemical and biophysical research communications 2006 Aug 4;346(3):746-50
A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro.
Giraud A, Dicristofaro J, De Micco C, Lejeune PJ, Barbaria J, Mallet B
Biochemical and biophysical research communications 2005 Dec 16;338(2):1000-4
Biochemical and biophysical research communications 2005 Dec 16;338(2):1000-4
No comments: Submit comment
No validations: Submit validation data