HPA018169

CCNE1 antibody from Sigma-Aldrich
CCNE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018169
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018169, RRID:AB_1847384
Product name
Anti-CCNE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018169
Antibody type
Polyclonal
Antigen
G1/S-specific cyclin-E1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMA
KIDRTARDQCGSQPWDNNAVCADPCSLIPTPD
Storage
-20C
Provider Type Product Number
- No reagents -