Antibody data
- Product number
- HPA021241
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021241, RRID:AB_1855299
- Product name
- Anti-PHGDH
- Provider product page
- Atlas Antibodies - HPA021241
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKK
GVRVVNCARGGIVDEGALLRALQSGQCAGAALDVF
TEEPPRDRALVDHENVISCPHLGASTKEAQSRCGE
EIAVQFVDM
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
NRF2 regulates serine biosynthesis in non–small cell lung cancer
DeNicola G, Chen P, Mullarky E, Sudderth J, Hu Z, Wu D, Tang H, Xie Y, Asara J, Huffman K, Wistuba I, Minna J, DeBerardinis R, Cantley L
Nature Genetics 2015 October;47(12):1475-1481
An epitope tag alters phosphoglycerate dehydrogenase structure and impairs ability to support cell proliferation
Mattaini K, Brignole E, Kini M, Davidson S, Fiske B, Drennan C, Vander Heiden M
Cancer & Metabolism 2015 December;3(1)
Cells deficient in base-excision repair reveal cancer hallmarks originating from adjustments to genetic instability
Markkanen E, Fischer R, Ledentcova M, Kessler B, Dianov G
Nucleic Acids Research 2015 April;43(7):3667-3679
Mouse Genetics Suggests Cell-Context Dependency for Myc-Regulated Metabolic Enzymes during Tumorigenesis
Nilsson L, Plym Forshell T, Rimpi S, Kreutzer C, Pretsch W, Bornkamm G, Nilsson J, Clurman B
PLoS Genetics 2012 March;8(3)
Serine starvation induces stress and p53-dependent metabolic remodelling in cancer cells
Maddocks O, Berkers C, Mason S, Zheng L, Blyth K, Gottlieb E, Vousden K
Nature 2012 December;493(7433):542-546
Functional genomics reveal that the serine synthesis pathway is essential in breast cancer
Possemato R, Marks K, Shaul Y, Pacold M, Kim D, Birsoy K, Sethumadhavan S, Woo H, Jang H, Jha A, Chen W, Barrett F, Stransky N, Tsun Z, Cowley G, Barretina J, Kalaany N, Hsu P, Ottina K, Chan A, Yuan B, Garraway L, Root D, Mino-Kenudson M, Brachtel E, Driggers E, Sabatini D
Nature 2011 August;476(7360):346-350
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line U-87 MG.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and A-549 using Anti-PHGDH antibody. Corresponding PHGDH RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Western blot analysis using Anti-PHGDH antibody HPA021241 (A) shows similar pattern to independent antibody HPA024031 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA024031
- Antibody provider
- Atlas Antibodies
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human breast cancer shows moderate to strong cytoplasmic positivity in tumor cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
- Sample type
- HUMAN