HPA021241

PHGDH antibody from Sigma-Aldrich
PDG, PGDH, SERA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021241
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021241, RRID:AB_1855299
Product name
Anti-PHGDH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021241
Antibody type
Polyclonal
Antigen
D-3-phosphoglycerate dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKK
GVRVVNCARGGIVDEGALLRALQSGQCAGAALDVF
TEEPPRDRALVDHENVISCPHLGASTKEAQSRCGE
EIAVQFVDM
Storage
-20C
Provider Type Product Number
- No reagents -