HPA031621

FASTK antibody from MilliporeSigma / Merck KGaA
FAST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031621
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031621, RRID:AB_10611966
Product name
Anti-FASTK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031621
Antibody type
Polyclonal
Antigen
Fas-activated serine/threonine kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLG
SRALRERHLGLMGYQLLPLPFEELESQRGLPQLKS
YLRQKLQAL
Storage
-20C
Provider Type Product Number
- No reagents -